IGF-1 LR3 1MG

$104.00

IGF-1 LR3 is a potent research peptide used to study cell growth. It is more effective than standard IGF-1 due to its extended half-life and increased potency, making it valuable for research on muscle development.

139 in stock

Product Usage: This product is designated as a "Novelty Peptide" and is intended solely for specialized applications in controlled settings. It is not intended for any specific biological, therapeutic, or diagnostic use. All information provided on this website is for informational and educational purposes only and should not be construed as guidance for any particular application or usage.

IGF-1 LR3 (Long Arginine 3-IGF-1) is a synthetic analog of human insulin-like growth factor 1 (IGF-1). It is an 83-amino acid peptide with a molecular weight of 9117.60 g/mol. IGF-1 LR3 differs from native IGF-1 by the substitution of an arginine for glutamic acid at position 3 and the addition of a 13-amino acid extension at the N-terminus. These modifications result in significantly reduced binding to IGF binding proteins, increased biological potency, and extended half-life compared to native IGF-1

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula: C400H625N111O115S9

Molecular Weight: 9117.60 g/mol

CAS Number: 946870-92-4

  1. Enhanced Potency: IGF-1 LR3 has been shown to be approximately three times more potent than native IGF-1 in stimulating cell proliferation and survival.
  2. Increased Half-life: The half-life of IGF-1 LR3 is significantly longer (20-30 hours) compared to native IGF-1 (12-15 hours), allowing for less frequent dosing.
  3. Muscle Growth: Studies have demonstrated that IGF-1 LR3 can promote muscle cell proliferation and hypertrophy, making it of interest in treating muscle-wasting conditions.
  4. Reduced IGFBP Binding: IGF-1 LR3 has very low affinity for IGF binding proteins, which allows for greater bioavailability and enhanced biological activity.
  5. Fetal Growth: Research in animal models has shown that IGF-1 LR3 can promote organ-specific growth in fetuses, potentially offering therapeutic applications for intrauterine growth restriction.

  1. Clinical Applications: Further research is needed to explore the potential therapeutic uses of IGF-1 LR3 in conditions such as growth hormone deficiency, muscle-wasting diseases, and intrauterine growth restriction.
  2. Long-term Safety: Extended studies are required to evaluate the long-term effects and safety profile of IGF-1 LR3, particularly in diverse patient populations.
  3. Delivery Methods: Investigation into optimal delivery methods and dosing regimens for different conditions could enhance the therapeutic potential of IGF-1 LR3.
  4. Combination Therapies: Exploring potential synergistic effects of IGF-1 LR3 with other growth factors or therapeutic agents could open new avenues for treatment in various medical fields.
  5. Mechanism of Action: Further research is needed to fully elucidate the molecular mechanisms by which IGF-1 LR3 exerts its diverse effects across different tissue types.

  1. Tomas, F. M., et al. (1993). Anabolic effects of insulin-like growth factor-I (IGF-I) and an IGF-I variant in normal female rats. Journal of Endocrinology, 137(3), 413-421. [Online].
    Available: https://pubmed.ncbi.nlm.nih.gov/8229461/
  2. Philippou, A., et al. (2007). The role of the insulin-like growth factor 1 (IGF-1) in skeletal muscle physiology. In Vivo, 21(1), 45-54. [Online].
    Available: https://pubmed.ncbi.nlm.nih.gov/17354613/
  3. Stremming, J., et al. (2021). IGF-1 Increases Fetal Organ Growth. Children's Hospital Colorado. [Online].
    Available: https://www.childrenscolorado.org/advances-answers/recent-articles/igf1/
  4. Kolomin, T., et al. (2013). A new generation of drugs: synthetic peptides based on natural regulatory peptides. Neuroscience and Behavioral Physiology, 43(7), 880-891. [Online].
    Available: https://pubmed.ncbi.nlm.nih.gov/23864238/
  5. Qkine. (2024). Recombinant human/bovine/porcine IGF-1 LR3 protein (Qk041). [Online].
    Available: https://qkine.com/product/recombinant-human-igf1-lr3-protein-qk041/
IGF-1 LR3 represents a promising avenue for research in various fields, including muscle growth, fetal development, and metabolic disorders. As with all research peptides, it is important to use IGF-1 LR3 under controlled conditions, and its potential benefits and risks require ongoing evaluation through further scientific studies.